PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.5007s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 295aa    MW: 33435.7 Da    PI: 7.516
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.5007s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.21.5e-3765123260
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                          +++ ++cprC+s+ntkfCyynnysl+qPry+Ck+CrryWt+GG+lrnvPvGgg+rknkk
  Araha.5007s0002.1.p  65 PQEPRNCPRCNSSNTKFCYYNNYSLAQPRYLCKSCRRYWTEGGSLRNVPVGGGSRKNKK 123
                          67899****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2764119IPR003851Zinc finger, Dof-type
PfamPF027018.2E-3367123IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.44469123IPR003851Zinc finger, Dof-type
PROSITE patternPS01361071107IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MDHHDQYHHH DQYQHQMTIT NNNPYNTIVT TQPPPPTTTT MDSTTATTMI MDDEKKLMTT  60
MSTRPQEPRN CPRCNSSNTK FCYYNNYSLA QPRYLCKSCR RYWTEGGSLR NVPVGGGSRK  120
NKKLPLLLSN SSTSSSTKNL PDLNPPFVFT SSSNPSKTHQ NNNDLSLSFS SHVQDKRAQG  180
HYGHFTEQVV TGGQNCLFQA PMGMIQFRQE YDHDHHKKNL GFSLDRNEEE ISNHDNFVVN  240
GEGSKMMYPY GDHEDRHQHN HVRHDDGNKK REGGSSNELW SGIILGGDSG GPTW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL1614910.0AL161491.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 3.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankTM018A100.0AF013294.1 Arabidopsis thaliana BAC TM018A10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010428013.11e-168PREDICTED: dof zinc finger protein DOF4.1
SwissprotQ9M1611e-165DOF41_ARATH; Dof zinc finger protein DOF4.1
TrEMBLD7M5061e-163D7M506_ARALL; Putative uncharacterized protein
TrEMBLR0HC391e-164R0HC39_9BRAS; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_60029011e-163(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM146951720
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00940.11e-152Dof family protein